Comparison

CD45 Rabbit mAb European Partner

Item no. A19021-20ul
Manufacturer Abclonal
Amount 20ul
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P
Specific against Human
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence SDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFG
NCBI PTPRC
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias B220;CD45;CD45R;GP180;L-CA;LCA;LY5;T200;PTPRC
Similar products CD45, PTPRC, L-CA, T200, B220, LCA, GP180, CD45R, LY5
Available
Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported.
Route
Recombinant protein
Manufacturers Category
Monoclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 194-390 of human CD45 (NP_002829.3).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200
Protein Size
147kDa
Manufacturers Research Area
Signal Transduction, Kinase, Tyrosine kinases, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, CDs, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, Neuroscience, Cell Type Marker, Stem Cells, Hematopoietic Progenitors
Gene Symbol
PTPRC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20ul
Available: In stock
available

Delivery expected until 9/27/2024 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close