Comparison

Pan Cadherin Rabbit pAb European Partner

Item no. A18682-1000uL
Manufacturer Abclonal
Amount 1000 uL
Category
Type Antibody Polyclonal
Applications WB, IP, ELISA
Specific against Human
Isotype IgG
Purity Affinity purification
Sequence RPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NCBI CDH1/CDH2/CDH3/CDH4
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CDH1/CDH2/CDH3/CDH4
Available
Background
Cadherin is one of a class of integral-membrane glycoproteins that are involved in cell to cell attachment for preserving the integrity of all solid tissues. Cadherins have three major regions: the Ca2+ -dependent extracellular region that mediates adhesion (cadherin to cadherin) for cell to cell binding; the transmembrane region; and the cytoplasmic region that extends into the cell and interacts with catenins, which in turn are linked to the actin of the cytoskeleton. Cadherins are differentially expressed during development and in adult organs. Since many cell types express multiple cadherin subclasses simultaneously (the combination differs with cell type), it can be inferred that the adhesion properities of individual cells are thus governed by varying the combinations of cadherins. Altered expression of cadherins are involved in invasion and metastasis of tumour cells. The classical cadherins (e.g. E-, N-, and P-cadherins) are the most common family members. E-cadherin (also known as uvomorulin) is concentrated in the belt desmosome in epithelial cells; N-cadherin is found in nerve, muscle, and lens cells and helps maintain the integrity of neuronal aggregates; P-cadherin is expressed in placental and epidermal cells.
Route
Synthetic peptide
Manufacturers Category
Polyclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 800-882 of human pan-cadherin (NP_004351.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000|IP, 1:1000 - 1:5000
Gene Symbol
CDH1/CDH2/CDH3/CDH4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Delivery expected until 8/23/2024 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close