« Back
Home /
Tulp2 Rabbit pAb

Tulp2 Rabbit pAb

Item no.	A18256-100uL
Manufacturer	Abclonal
Amount	100 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA, IHC-P
Specific against	Mouse
Isotype	IgG
Purity	Affinity purification
Sequence	FQSDSSWGLGVGSPFLQENVPQAHLPSGAHSALVTMSYVADGSGERAPLLSPRGAVYTRGNGPAVRHHLCWLPDSSDSDVEEVTMEDIPVISRPPQTNLANLRRGWLASPGPGISQEEKEEEVGSTDARVEDKTPSPDPDPDPTVNSDGDHGDLAPCKVEENTAQKNTETASGIGDEDREKGEVTESTETNYAPVASKVLQGDDGDASNHNAWNMTCPQPRIPGPRLG
NCBI	Tulp2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Pdet
Available
Background	Predicted to enable phosphoric diester hydrolase activity. Predicted to be involved in protein localization to cilium. Predicted to be located in cytoplasm and extracellular region. Predicted to be active in cilium. Is expressed in urogenital ridge. Orthologous to human TULP2 (TUB like protein 2).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 78-305 of mouse Tulp2 (NP_032833.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	63kDa
Gene Symbol	Tulp2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 22 days

Compare

Add to wishlist

Recommend by mail