« Back
Home /
GADD45A Rabbit pAb

GADD45A Rabbit pAb

Item no.	A17470-500uL
Manufacturer	Abclonal
Amount	500 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAE
NCBI	GADD45A
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DDIT1;GADD45;GADD45A
Available
Background	This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GADD45A (NP_001915.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	18kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, DNA Damage Repair, ATM Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Cell Cycle, Centrosome, Cell Cycle Control-G2 M DNA Damage Checkpoint, Immunology Inflammation, T Cell Receptor Signaling Pathway
Gene Symbol	GADD45A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 17 days

Compare

Add to wishlist

Recommend by mail