« Back
Home /
COL9A2 Rabbit pAb

COL9A2 Rabbit pAb

Item no.	A17461-200ul
Manufacturer	Abclonal
Amount	200ul
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP
NCBI	COL9A2
ECLASS 5.1	32160702
ECLASS 6.1	32160702
ECLASS 8.0	32160702
ECLASS 9.0	32160702
ECLASS 10.0.1	32160702
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DJ39G22.4;EDM2;MED;STL5;COL9A2
Similar products	MED, DJ39G22.4, EDM2, COL9A2, STL5
Available
Background	This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia.
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-689 of human COL9A2 (NP_001843.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	65kDa
Gene Symbol	COL9A2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ul

available

Delivery expected until 8/23/2024

Express Delivery: Save 23 days

Compare

Add to wishlist

Recommend by mail