« Back
Home /
FAT4 Rabbit pAb

FAT4 Rabbit pAb

Item no.	A17212-20ul
Manufacturer	Abclonal
Amount	20ul
Category	Oncology Antibodies By Cell Type Carcinoma Primary Antibodies
Type	Antibody Primary
Applications	WB, IF, ICC, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	GGPVGTQAAAPGTADNTLPMKLGQQAGTFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAANEEGKAGTTKPVPKDGEAEQYV
NCBI	FAT4
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FAT4;CDHF14;CDHR11;FAT-J;FATJ;HKLLS2;NBLA00548;VMLDS2
Available
Background	The protein encoded by this gene is a member of the protocadherin family. This gene may play a role in regulating planar cell polarity (PCP). Studies in mice suggest that loss of PCP signaling may cause cystic kidney disease, and mutations in this gene have been associated with Van Maldergem Syndrome 2. Alternatively spliced transcript variants have been noted for this gene.
Route	Synthetic Peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 4900-4981 of human FAT4 (NP_078858.4).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	543kDa
Manufacturers Research Area	Cancer, Invasion and Metastasis, Signal Transduction, Cell Biology Developmental Biology, Cell Adhesion, Cadherins, Cytoskeleton, Neuroscience, Calcium Signaling
Gene Symbol	FAT4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ul

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail