Comparison

Smad2 Rabbit pAb European Partner

Item no. A16912-50ul
Manufacturer Abclonal
Amount 50ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence LPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE
NCBI SMAD2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias JV18;JV18-1;MADH2;MADR2;hMAD-2;hSMAD2;Smad2;SMAD2
Similar products Smad2, SMAD2, JV18-1, MADH2, hSMAD2, hMAD-2, hMAD-2, JV18, MADR2
Available
Background
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 175-270 of human Smad2 (NP_005892.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
52kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Protein phosphorylation, Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, TGF-b-Smad Signaling Pathway, ESC Pluripotency and Differentiation, Stem Cells, Cardiovascular, Angiogenesis
Gene Symbol
SMAD2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close