Item no. |
A16912-50ul |
Manufacturer |
Abclonal
|
Amount |
50ul |
Category |
|
Type |
Antibody Polyclonal |
Applications |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Purity |
Affinity purification |
Sequence |
LPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE |
NCBI |
SMAD2 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
JV18;JV18-1;MADH2;MADR2;hMAD-2;hSMAD2;Smad2;SMAD2 |
Similar products |
Smad2, SMAD2, JV18-1, MADH2, hSMAD2, hMAD-2, hMAD-2, JV18, MADR2 |
Available |
|
Background |
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene. |
Route |
Recombinant protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 175-270 of human Smad2 (NP_005892.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200 |
Protein Size |
52kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, Transcription Factors, Protein phosphorylation, Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, TGF-b-Smad Signaling Pathway, ESC Pluripotency and Differentiation, Stem Cells, Cardiovascular, Angiogenesis |
Gene Symbol |
SMAD2 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.