Comparison

Cyclin E1 Rabbit pAb European Partner

Item no. A16801-50uL
Manufacturer Abclonal
Amount 50 uL
Category
Type Antibody Polyclonal
Applications IF, ICC, ELISA
Specific against Human
Isotype IgG
Purity Affinity purification
Sequence AASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
NCBI CCNE1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CCNE; pCCNE1
Available
Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2, whose activity is required for cell cycle G1/S transition. This protein accumulates at the G1-S phase boundary and is degraded as cells progress through S phase. Overexpression of this gene has been observed in many tumors, which results in chromosome instability, and thus may contribute to tumorigenesis. This protein was found to associate with, and be involved in, the phosphorylation of NPAT protein (nuclear protein mapped to the ATM locus), which participates in cell-cycle regulated histone gene expression and plays a critical role in promoting cell-cycle progression in the absence of pRB.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human Cyclin E1 (NP_001229.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution
IF/ICC, 1:50 - 1:200
Protein Size
47kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Protein phosphorylation, Cancer, ATM Signaling Pathway, Cell Biology Developmental Biology, Cell Cycle, Centrosome, Cell Cycle Control-G1 S Checkpoint
Gene Symbol
CCNE1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close