« Back
Home /
GPR62 Rabbit pAb

GPR62 Rabbit pAb

Item no.	A16163-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	GTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQF
NCBI	GPR62
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GPR62;GPCR8;KPG_005
Available
Background	Enables arrestin family protein binding activity. Involved in G protein-coupled receptor signaling pathway; inositol phosphate-mediated signaling; and positive regulation of cAMP-mediated signaling. Located in endosome and plasma membrane. Part of receptor complex.
Route	Synthetic Peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	38kDa
Manufacturers Research Area	G protein signaling, G-Protein-Coupled ReceptorsGPCR, Neuroscience
Gene Symbol	GPR62

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 23 days

Compare

Add to wishlist

Recommend by mail