« Back
Home /
FAM3B Rabbit pAb

FAM3B Rabbit pAb

Item no.	A14215-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
NCBI	FAM3B
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	2-21; ORF9; PANDER; PRED44; C21orf11; C21orf76
Available
Background	Involved in insulin secretion. Located in extracellular exosome.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human FAM3B (NP_478066.3).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	26kDa
Manufacturers Research Area	Endocrine Metabolism, Endocrine and metabolic diseases, Diabetes, Obesity, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway
Gene Symbol	FAM3B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 8/23/2024

Express Delivery: Save 2 days

Compare

Add to wishlist

Recommend by mail