« Back
Home /
Gsdmc2 Rabbit pAb

Gsdmc2 Rabbit pAb

Item no.	A12002-200uL
Manufacturer	Abclonal
Amount	200 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	DSQLNLLAQSVEMGILPHQVELVKSILQPNFKYPWNIPFTLQPQLLAPLQGEGLAITYELLEECGLKMELNNPRSTWDLEAKMPLSALYGSLSFLQQLRKA
NCBI	Gsdmc2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	9130023H10
Available
Background	Predicted to enable phosphatidylinositol-4, 5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Acts upstream of or within intestinal epithelial cell development. Predicted to be located in cytoplasm. Is expressed in gut and urinary system. Orthologous to human GSDMC (gasdermin C).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 367-467 of mouse Gsdmc2 (NP_001161746.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	54kDa
Manufacturers Research Area	Cancer, Tumor biomarkers
Gene Symbol	Gsdmc2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 31 days

Compare

Add to wishlist

Recommend by mail