« Back
Home /
HSF2BP Rabbit pAb

HSF2BP Rabbit pAb

Item no.	A10603-50uL
Manufacturer	Abclonal
Amount	50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Mouse
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MAATVGDGSGTEEACRNMESKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGELLESFQKLKMVEKNLERKEQELEQLIMDREHFKARLETAQADSGREKKEKLALRQQLNEAKQQLLQQAEYCTQMGAVTCTLLWGVSSSEEVVKTILGGDKALKFFNITGQTMESFVKSLDGDVKEVDSDENQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTMLQLLGDLKPGQCTKLKVLMLMSLYNVSINSKGLKYIT
NCBI	Hsf2bp
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Meilb2; 4932437G14Rik
Available
Background	Involved in meiosis I and spermatogenesis. Located in chromosome. Is expressed in several structures, including genitourinary system; nervous system; sensory organ; surface ectoderm; and thymus. Human ortholog(s) of this gene implicated in primary ovarian insufficiency 19. Orthologous to human HSF2BP (heat shock transcription factor 2 binding protein).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of mouse HSF2BP (NP_083178.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	37kDa
Manufacturers Research Area	Signal Transduction
Gene Symbol	Hsf2bp

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail