« Back
Home /
NEPRO Rabbit pAb

NEPRO Rabbit pAb

Item no.	A10520-500uL
Manufacturer	Abclonal
Amount	500 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	EQLPKMNEDTLDRLSKPSEQMTSNPQSTVDLGQPVKACKRTRKEKPLGFDLRAFCTRLGNKATQETNRDFKYSQSKLKTTKLPSQQLRTHWANDTVQRIRKTKTFAQLSEEIEMAIVWSRSKKLKTQATFLGNKLLKSNRFRHVESQGYSLTKKLQCMKTSLCNCLLRGSRTSTSEHPPRQRRSKYKVLSRQRKPQRKLQSTLLKETQQVPEGTLKNTRDSSAKRRCSGTVQRSDVCPNGKQVLRKLAKPDLKTK
NCBI	Nepro
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	NEPRO;C3orf17;NET17;bc027231
Available
Background	Acts upstream of or within negative regulation of neuron differentiation and positive regulation of Notch signaling pathway. Located in nucleolus. Is expressed in several structures, including adipose tissue; alimentary system; genitourinary system; integumental system; and nervous system. Human ortholog(s) of this gene implicated in anauxetic dysplasia 3. Orthologous to human NEPRO (nucleolus and neural progenitor protein).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 263-564 of mouse NEPRO (NP_666084.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	63kDa
Manufacturers Research Area	Cell Biology & Developmental Biology
Gene Symbol	Nepro

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 17 days

Compare

Add to wishlist

Recommend by mail