Comparison

Bcl10 Rabbit pAb European Partner

Item no. A0191-50uL
Manufacturer Abclonal
Amount 50 uL
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLK
NCBI BCL1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CLAP; mE10; CIPER; IMD37; c-E10; CARMEN
Available
Background
This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human Bcl10 (NP_003912.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
26kDa
Manufacturers Research Area
Cancer, Invasion and Metastasis, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Caspases, Endocrine Metabolism, Immunology Inflammation, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway
Gene Symbol
BCL10

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close