« Back
Home /
GluA2/GluR2 glutamate receptor

GluA2/GluR2 glutamate receptor

Item no.	75-002
Manufacturer	Antibodies Incorporated
Amount	100 uL
Category	Neuroscience Molecular Targets for Neuroscience Neural Signaling Antibodies Immunohistochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
Applications	IHC, IB
Clone	L21/32
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Available
Applications info	Immunoblot (IB), Immunohistochemistry (IHC), Immuno-gold EM
Category Name	Receptors
ABID	RRID:AB_2232661
Cross Reactivity	Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
Description	Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491) Mouse: 98% identity (49/50 amino acids identical) Human: 98% identity (49/50 amino acids identical) 100% identity between Flip and Flop isoforms > 70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
Expected Banding Pattern	90 kDa
Target	GluA2/GluR2 glutamate receptor
Validation	T\|Br-IB\|Br-IHC\|KO

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 2/14/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail