« Back
Home /
Kv2.2 potassium channel

Kv2.2 potassium channel

Item no.	75-369
Manufacturer	Antibodies Incorporated
Amount	100 ul
Category	Antibodies Immunohistochemistry Immunocytochemistry Cardiovascular Research Ischemia & Reperfusion Injury Primary Antibodies Immunoblot
Type	Antibody Monoclonal
Applications	IHC, ICC, IB
Clone	N372B/1
Specific against	Human, Mouse, Rat
Host	Mouse
Isotype	IgG1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Available
Applications info	Immunoblot (IB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Category Name	Membrane Channels
ABID	RRID:AB_2315870
Channel Target	K+ Channels
Cross Reactivity	Does not cross-react with Kv2.2 short isoform Does not cross-react with Kv2.1
Description	Immunogen: Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2) Mouse: 94% identity (180/191 amino acids identical) Human: 84% identity (161/191 amino acids identical) < 50% identity with Kv2.1 and other Kv2 channels 100% identity with Kv2.2 short isoform for first 47 amino acids (ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)
Expected Banding Pattern	120 kDa
Target	Kv2.2 potassium channel
Validation	T\|Br-IB\|Br-IHC\|KO

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/13/2024