« Back
Home /
β-Amyloid (1-28)-Lys(Biotin)-NH2 - 0.5 mg

β-Amyloid (1-28)-Lys(Biotin)-NH2 - 0.5 mg

Item no.	AS-62465
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Biotin
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Lys(Biotin)-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Shipping condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid; beta-amyloid (1-28)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3616.2
Description	This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Product Group	LB1A1Z
Research Area	Neuroscience / Lyophilized
Sequence One-Letter Code	DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
GTIN	5400535148980
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-62465-safety-datasheet.pdf