« Back
Home /
β-Amyloid A4 Protein Precursor (740-770), APP (C31) - 1 mg

β-Amyloid A4 Protein Precursor (740-770), APP (C31) - 1 mg

Item no.	AS-62073
Manufacturer	AnaSpec
Amount	1 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding By Cell Type Peptides & Proteins Adenocarcinoma Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH
Citations	Chen, Y. et al. J. Cell Biol. 163, 27 (2003); Lu, D. et al. Nat. Med. 6, 397 (2000).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Shipping condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3717.3
Description	This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Product Group	LB1A1Z
Research Area	Neuroscience / Lyophilized
Sequence One-Letter Code	AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
GTIN	5400535149918
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-62073-safety-datasheet.pdf