« Back
Home /
PACAP (1-27), amide, human, ovine, rat

PACAP (1-27), amide, human, ovine, rat

Item no.	AS-22527
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Specific against	other
Purity	Peak Area by HPLC >=95%
Sequence	H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
Citations	Ref: Miyata, A. et al. BBRC 164, 567(1998); Chik, C. et al. J. Neurochem. 67, 1005 (1996).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Available
Description	PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
MW	3147, 7
One-Letter Code	HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Product Group	LB1A1Z
Research Topic	Diabetes and Insulin Related
Research Topic 2	Neuroendocrine
Shipping	RT
Storage	-20C

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 8/16/2024