« Back
Home /
CMKLR1 Rabbit pAb

CMKLR1 Rabbit pAb

Item no.	A16358-50ul
Manufacturer	Abclonal
Amount	50ul
Category	Antibodies Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	NRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPLATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSH
NCBI	CMKLR1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CMKLR1;CHEMERINR;ChemR23;DEZ;RVER1
Available
Background	Enables adipokinetic hormone binding activity and adipokinetic hormone receptor activity. Involved in several processes, including negative regulation of NF-kappaB transcription factor activity; positive regulation of macrophage chemotaxis; and regulation of calcium-mediated signaling. Located in plasma membrane.
Route	Synthetic Peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	42kDa
Manufacturers Research Area	Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Cell Biology Developmental Biology, Cytoskeleton, Extracellular Matrix, Bone
Gene Symbol	CMKLR1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 29 days

Compare

Add to wishlist

Recommend by mail