Comparison

CREBBP Rabbit pAb European Partner

Item no. A14237-200ul
Manufacturer Abclonal
Amount 200ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Mouse
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGL
NCBI Crebbp
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CREBBP;CBP;KAT3A;RSTS;RSTS1
Available
Background
Enables several functions, including DNA-binding transcription factor binding activity; TFIIB-class transcription factor binding activity; and disordered domain specific binding activity. Involved in several processes, including cellular response to virus; face morphogenesis; and negative regulation of interferon-beta production. Acts upstream of or within cellular response to hepatocyte growth factor stimulus; germ-line stem cell population maintenance; and regulation of gene expression. Located in chromatin and nucleus. Part of RNA polymerase II transcription regulator complex; histone acetyltransferase complex; and outer kinetochore. Is expressed in several structures, including alimentary system; embryo ectoderm; genitourinary system; heart; and skin. Used to study Rubinstein-Taybi syndrome; acute myeloid leukemia; autism spectrum disorder; and myelodysplastic syndrome. Human ortholog(s) of this gene implicated in Rubinstein-Taybi syndrome; acute lymphoblastic leukemia; and acute myeloid leukemia. Orthologous to human CREBBP (CREB binding protein).
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-445 of mouse CREBBP (NP_001020603.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
265kDa
Manufacturers Research Area
Epigenetics & Nuclear Signaling, Chromatin Modifying Enzymes, Acetylation, Transcription Factors, Nuclear Receptor Signaling, Cancer, Signal Transduction, Cell Biology & Developmental Biology, TGF-b-Smad Signaling Pathway, Notch Signaling Pathway, Wnt/β-Catenin Signaling Pathway, Endocrine & Metabolism, Mitochondrial metabolism, Lipid Metabolism, Immunology & Inflammation, NF-kB Signaling Pathway, Neuroscience, Neurodegenerative Diseases, Stem Cells, Cardiovascular, Angiogenesis, Binding factor, Binding factor
Gene Symbol
Crebbp

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200ul
Available: In stock
available

Delivery expected until 9/27/2024 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close