Item no. |
A13976-200ul |
Manufacturer |
Abclonal
|
Amount |
200ul |
Category |
|
Type |
Antibody Polyclonal |
Applications |
WB, IF, ICC, ELISA |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEP |
NCBI |
ERBB3 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
ERBB3;ErbB-3;HER3;LCCS2;MDA-BF-1;c-erbB-3;c-erbB3;erbB3-S;p180-ErbB3;p45-sErbB3;p85-sErbB3 |
Available |
|
Background |
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. |
Route |
Recombinant protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 20-285 of human ErbB3/HER3 (NP_001973.2). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:2000|IF/ICC, 1:50 - 1:200 |
Protein Size |
148kDa |
Manufacturers Research Area |
Protein phosphorylation, Cancer, Tumor biomarkers, Signal Transduction, G protein signaling, Kinase, Tyrosine kinases, ErbB-HER Signaling Pathway, Cell Biology Developmental Biology, Growth factors, Immunology Inflammation |
Gene Symbol |
ERBB3 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.