Item no. |
A2568-200ul |
Manufacturer |
Abclonal
|
Amount |
200ul |
Category |
|
Type |
Antibody Polyclonal |
Applications |
WB, IF, IP, ICC, ELISA, IHC-P |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
FPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIA |
NCBI |
AIFM1 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
AIF;CMT2D;CMTX4;COWCK;COXPD6;DFNX5;NADMR;NAMSD;PDCD8;AIFM1 |
Similar products |
AIFM1 |
Available |
|
Background |
This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and cognitive disability. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10. |
Route |
Recombinant protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 334-613 of human AIF (NP_004199.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200|IP, 1:50 - 1:100 |
Protein Size |
67kDa |
Manufacturers Research Area |
Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis |
Gene Symbol |
AIFM1 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.