« Back
Home /
REG3G Rabbit pAb

REG3G Rabbit pAb

Item no.	A2146-200ul
Manufacturer	Abclonal
Amount	200ul
Category	Oncology Metabolism Diabetes Antibodies Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies By Organ Testicular & Prostate Cancer
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Mouse
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
NCBI	Reg3g
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	REG3G;LPPM429;PAP IB;PAP-1B;PAP1B;PAPIB;REG III;REG-III;UNQ429;REGIII
Similar products	REG3G
Available
Background	This gene encodes a C-type lectin that demonstrates bactericidal activity. This gene is predominantly expressed in the distal small intestine where the encoded protein undergoes proteolytic processing by trypsin. Mice lacking the encoded protein exhibit altered mucus distribution, increased bacterial contact with the epithelium, and elevated inflammatory markers in the ileum, and low-grade inflammation.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-174 of mouse REG3G (NP_035390.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:10 - 1:100
Protein Size	19kDa
Gene Symbol	Reg3g

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 31 days

Compare

Add to wishlist

Recommend by mail