Comparison

WNT5A Rabbit pAb European Partner

Item no. A2133-100ul
Manufacturer Abclonal
Amount 100ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence AQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPS
NCBI WNT5A
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias hWNT5A;Wnt5a;WNT5A
Similar products Wnt5a
Available
Background
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 65-305 of human WNT5A (NP_003383.2).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
42kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Cancer, Tumor suppressors, Signal Transduction, G protein signaling, mTOR Signaling Pathway, Cell Biology Developmental Biology, Microtubules, Wnt ��-Catenin Signaling Pathway, ESC Pluripotency and Differentiation, Neuroscience, Stem Cells
Gene Symbol
WNT5A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close