« Back
Home /
COL4A3BP Rabbit pAb

COL4A3BP Rabbit pAb

Item no.	A15376-200ul
Manufacturer	Abclonal
Amount	200ul
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	QKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
NCBI	CERT1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	COL4A3BP;CERT;CERTL;GPBP;MRD34;STARD11
Available
Background	This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Three transcript variants encoding different isoforms have been found for this gene.
Route	Recombinant Protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 369-598 of human COL4A3BP (NP_112729.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:200 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	71kDa
Manufacturers Research Area	Cancer, Signal Transduction, Kinase, Cell Biology Developmental Biology, Cell Cycle, Cytoskeleton, Extracellular Matrix, Endocrine Metabolism, Amino acid metabolism, Lipid Metabolism, Immunology Inflammation
Gene Symbol	CERT1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail