Comparison

IL6 Rabbit pAb European Partner

Item no. A14687-100ul
Manufacturer Abclonal
Amount 100ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NCBI IL6
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias IL6;BSF-2;BSF2;CDF;HGF;HSF;IFN-beta-2;IFNB2;IL-6
Available
Background
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2).
Route
Recombinant Protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 30-212 of human IL6 (NP_000591.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
24kDa
Manufacturers Research Area
Cancer, Tumor immunology, Invasion and Metastasis, Cell Biology Developmental Biology, Apoptosis, Growth factors, Endocrine Metabolism, Endocrine and metabolic diseases, Obesity, Immunology Inflammation, Cytokines, Interleukins, Jak-Stat-IL-6 Receptor Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, Neuroscience, Neurodegenerative Diseases, Neurodegenerative Diseases Markers, Other Neurological disorders, Cardiovascular, Angiogenesis
Gene Symbol
IL6

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close