Item no. |
A12575-100ul |
Manufacturer |
Abclonal
|
Amount |
100ul |
Category |
|
Type |
Antibody Polyclonal |
Applications |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
IMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHA |
NCBI |
SIRT2 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
SIRT2;SIR2;SIR2L;SIR2L2;sirtuin 2 |
Available |
|
Background |
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene. |
Route |
Synthetic peptide |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 300-350 of human SIRT2 (NP_036369.2). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200 |
Protein Size |
43kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, Epigenetic writers and erasers of core Histones, Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis |
Gene Symbol |
SIRT2 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.