« Back
Home /
Ki67 Rabbit pAb

Ki67 Rabbit pAb

Item no.	A11390-20ul
Manufacturer	Abclonal
Amount	20ul
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Cell Biology Cell Status Immunohistochemistry Western Blot Immunofluorescence Proliferation Viability Primary Antibodies By Organ Lung Cancer Bladder Cancer Breast Cancer Testicular & Prostate Cancer Cytoskeleton Markers
Type	Antibody Polyclonal
Applications	IF, ICC, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	GEVHSQFSTGHANSPCTIIIGKAHTEKVHVPARPYRVLNNFISNQKMDFKEDLSGIAEMFKTPVKEQPQLTSTCHIAISNSENLLGKQFQGTDSGEEPLLP
NCBI	MKI67
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MKI67;KIA;MIB-;MIB-1;PPP1R105;marker of proliferation Ki-67;Ki67
Available
Background	Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Ki67 (NP_002408.3).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	IF/ICC, 1:50 - 1:200
Protein Size	359kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, RNA Binding, Cancer, Tumor biomarkers, Cell Biology Developmental Biology, Cell Cycle, Neuroscience, Cell Type Marker, Neuron marker
Gene Symbol	MKI67

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 24 days

Compare

Add to wishlist

Recommend by mail