Comparison

HDAC5 Rabbit pAb European Partner

Item no. A0632-50ul
Manufacturer Abclonal
Amount 50ul
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence PLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
NCBI HDAC5
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias HDAC5;HD5;NY-CO-9
Available
Background
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene.
Route
Synthetic peptide
Manufacturers Category
Polyclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human HDAC5 (NP_005465.2).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
122kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Nuclear Receptor Signaling, Protein phosphorylation, Signal Transduction, Cell Biology Developmental Biology, Cell Cycle, Cell Cycle Control-G1 S Checkpoint, Wnt ��-Catenin Signaling Pathway, Immunology Inflammation, NF-kB Signaling Pathway, Stem Cells, Cardiovascular, Heart, Hypertrophy
Gene Symbol
HDAC5

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close