Comparison

EWSR1 Rabbit pAb European Partner

Item no. A1690-20ul
Manufacturer Abclonal
Amount 20ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence TTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
NCBI EWSR1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias EWSR1;EWS;EWS-FLI1;bK984G1.4
Available
Background
This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11; 22)(q24; q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human EWSR1 (NP_001156757.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
68kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Transcription Factors, RNA Binding, Cancer
Gene Symbol
EWSR1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20ul
Available: In stock
available

Delivery expected until 8/23/2024 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close