« Back
Home /
HRH2 Rabbit pAb

HRH2 Rabbit pAb

Item no.	A14170-50ul
Manufacturer	Abclonal
Amount	50ul
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	SFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPY
NCBI	HRH2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HRH2;H2R
Available
Background	Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. Histamine receptor H2 belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and stimulates gastric acid secretion. It also regulates gastrointestinal motility and intestinal secretion and is thought to be involved in regulating cell growth and differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HRH2 (NP_001124527.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	40kDa
Manufacturers Research Area	Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Kinase
Gene Symbol	HRH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 18 days

Compare

Add to wishlist

Recommend by mail