« Back
Home /
Kdm6b Rabbit pAb

Kdm6b Rabbit pAb

Item no.	A12763-50ul
Manufacturer	Abclonal
Amount	50ul
Category	Antibodies Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Mouse
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA
NCBI	Kdm6b
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KDM6B;JMJD3;Kdm6b
Available
Background	Enables beta-catenin binding activity; histone H3-tri/di-methyl-lysine-27 demethylase activity; and sequence-specific DNA binding activity. Involved in several processes, including histone H3-K27 demethylation; mesodermal cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including cellular response to hydrogen peroxide; histone demethylation; and positive regulation of transcription by RNA polymerase II. Located in nucleus. Is expressed in several structures, including brain; gut; liver; metanephros; and olfactory epithelium. Orthologous to human KDM6B (lysine demethylase 6B).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Kdm6b (NP_001017426.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	176kDa
Manufacturers Research Area	Epigenetics & Nuclear Signaling, Chromatin Modifying Enzymes, Demethylation, Immunology & Inflammation
Gene Symbol	Kdm6b

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

available

Delivery expected until 10/25/2024

Express Delivery: Save 24 days

Compare

Add to wishlist

Recommend by mail