« Back
Home /
PLA2G6 Rabbit pAb

PLA2G6 Rabbit pAb

Item no.	A14808-100ul
Manufacturer	Abclonal
Amount	100ul
Category	Metabolism Cholesterol & Lipid Metabolism Antibodies Western Blot Enzymes Fatty Acid Catabolism Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	GNTPLHLAMSKDNMEMVKALIVFGAEVDTPNDFGETPALIASKISKLITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHPLFSLDRTQPPAISLNNL
NCBI	Pla2g6
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PLA2G6;CaI-PLA2;GVI;INAD1;IPLA2-VIA;NBIA2;NBIA2A;NBIA2B;PARK14;PLA2;PNPLA9;iPLA2;iPLA2beta
Available
Background	Enables calcium-independent phospholipase A2 activity; palmitoyl-CoA hydrolase activity; and serine hydrolase activity. Involved in positive regulation of insulin secretion involved in cellular response to glucose stimulus. Predicted to be located in centriolar satellite; cytosol; and extracellular space. Predicted to be active in mitochondrion. Is expressed in 1st branchial arch maxillary component; olfactory placode; otic pit; and trunk somite. Used to study neurodegeneration with brain iron accumulation 2a. Human ortholog(s) of this gene implicated in dystonia 12; neuroaxonal dystrophy; and neurodegenerative disease (multiple). Orthologous to human PLA2G6 (phospholipase A2 group VI).
Route	Synthetic Peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of mouse PLA2G6 (NP_001185952.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	83kDa/89kDa
Manufacturers Research Area	Signal Transduction
Gene Symbol	Pla2g6

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 17 days

Compare

Add to wishlist

Recommend by mail