« Zurück
Home /
IP-10 (CXCL10)

IP-10 (CXCL10)

ArtNr	RLT-M10-025S
Hersteller	ReliaTech
Menge	5ug
Kategorie	Oncology Neuroscience Neuroinflammation By Cell Type Peptides & Proteins Recombinant Proteins
Typ	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human, Mouse, Rat, Monkey
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	Cxcl10, C7, IP10, CRG-2, INP10, IP-10, Ifi10, mob-1, Scyb10, gIP-10
Lieferbar
NCBI Gene ID	15945
Uniprot	P17515
Biological Activity	Assay #1: Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml.
Description	Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	77
Molecular Weight	8.7 kDa
mRNA RefSeq	NM_021274.2
Protein RefSeq	NP_067249.1
Protein Sequence	IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Purity Confirmation	> 98% by SDS-PAGE & HPLC analyses
Synonyms	Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
Uniprot ID	P17515

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5ug

lieferbar

Lieferung vsl. bis 16.08.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern