« Zurück
Home /
Recombinant Human DEFENSIN BETA 2

Recombinant Human DEFENSIN BETA 2

ArtNr	DS-01-0084
Hersteller	Raybiotech
Menge	20 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Purified recombinant protein - lyophilized
Applikationen	WB, ELISA, FA
Specific against	Human
Host	Hamster - Armenian
Purity	>98% by SDS PAGE and HPLC analysis.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	Defensin beta
Lieferbar
Application Information	ELISA (0.2-0.4ng/well), Functional Assays (10-100ng/ml), Western Blotting (1.5-3.0ng/lane)
Storage/Stability	Prior to reconstitution store at +4°C.After reconstitution store at -20°C.Storage in frost-free freezers is not recommended.This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. This protein may be stored for3 months from date of reconstitution.
Expressed Region	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Protein Name & Synonyms	DEFENSIN BETA 2,
Expression System	E.Coli
Concentration (lot specific)	~0.1mg/ml after reconstitution
Endotoxin Level	<0.1ng/ug
Preservative	None present
Molecular Weight (kDa)	4.3kD (41 amino acid sequence/residues)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.