« Zurück
Home /
Ras-Related C3 Botulinum Toxin substrate 1, Human Recombinant

Ras-Related C3 Botulinum Toxin substrate 1, Human Recombinant

Hersteller	Raybiotech
Kategorie	Peptides & Proteins Recombinant Proteins Cell Biology Cytoskeleton small GTPases Rho Subfamily
Typ	Proteins Recombinant
Specific against	Human
Format	Sterile Filtered colorless solution.
Menge	1 mg
Quantity options	50 ug 1 mg
ArtNr	228-11350-3
Targets	RAC1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Purity	Greater than 95.0% as determined by SDS-PAGE.
Storage/Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Formulation	The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.
Expressed Region	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.
Protein Name & Synonyms	P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein, Ras-related C3 botulinum toxin substrate 1, rho family small GTP binding protein Rac1, TC-25, MGC111543.
Expression System	E.Coli

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.