Vergleich

Mouse anti-Glypican-3 (511~560aa) (8C4-C1-F4)

ArtNr 131-0087-20
Hersteller Raybiotech
Menge 20 ug
Quantity options 100 ug 20 ug 200 ug
Kategorie
Typ Antibody
Applikationen ELISA
Clon 8C4-C1-F4
Specific against Human
Host Hamster - Armenian
Sequence KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Lieferbar
Application Information
ELISA (recommended work dilution = 1:80, 000)
Protein Name & Synonyms
Glypican-3 (511~560aa)
Reconstitution
Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml.
Expiration
12 months from the date of shipment when stored properly.
Clonality
Monoclonal
Preparation
Immunogen was polypeptide Glypican-3 (511~560aa)-KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with the immunogen. The IgG fraction of tissue culture supernatant was purified by Protein G/A affinity chromatography.
Western Blot
10% SDS-PAGE, Goat anti-mouse HRP: 1:5000.Lane:M: protein marker1: HepG2 cell lysate (10 µl)2: Hela cell lysate (10 µl)3: Mouse Liver lysate (10 µl)StorageThe antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 30.08.2024 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen