« Zurück
Home /
Mouse anti-Glypican-3 (511~560aa) (8C4-C1-F4)

Mouse anti-Glypican-3 (511~560aa) (8C4-C1-F4)

ArtNr	131-0087-100
Hersteller	Raybiotech
Menge	100 ug
Quantity options	100 ug 20 ug 200 ug
Kategorie	Oncology Neuroscience Neural Signaling Antibodies By Cell Type Blastoma Carcinoma Primary Antibodies
Typ	Antibody
Applikationen	ELISA
Clon	8C4-C1-F4
Specific against	Human
Host	Hamster - Armenian
Sequence	KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Application Information	ELISA (recommended work dilution = 1:80, 000)
Protein Name & Synonyms	Glypican-3 (511~560aa)
Reconstitution	Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml.
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal
Preparation	Immunogen was polypeptide Glypican-3 (511~560aa)-KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with the immunogen. The IgG fraction of tissue culture supernatant was purified by Protein G/A affinity chromatography.
Western Blot	10% SDS-PAGE, Goat anti-mouse HRP: 1:5000.Lane:M: protein marker1: HepG2 cell lysate (10 µl)2: Hela cell lysate (10 µl)3: Mouse Liver lysate (10 µl)StorageThe antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 30.08.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern