« Zurück
Home /
Anti-RAF1 Antibody

Anti-RAF1 Antibody

ArtNr	101-11392
Hersteller	Raybiotech
Menge	100 ug
Kategorie	Oncology Antibodies Western Blot ELISA Primary Antibodies By Organ Heart & Blood Cancer Proximity Ligation Analysis RNAi
Typ	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applikationen	WB, ELISA, RNAi, PLA
Clon	Monoclonal
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus)
Host	Hamster - Armenian
Isotype	IgG2b Kappa
Sequence	MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQR RASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHD CLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS LIGEELQVDF
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	RAF1
Versandbedingung	Gekühlt
Lieferbar
Specificity	Human
Format	In 1x PBS, pH 7.2
Gene Symbols	RAF1
Storage/Stability	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Protein Name & Synonyms	RAF1
Specicifity	Human
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal
Storage Buffer	1x PBS, pH 7.2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

101-11392.pdf

101-11392-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 24.01.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail