« Zurück
Home /
Anti-ZBTB16 Antibody

Anti-ZBTB16 Antibody

ArtNr	101-11954
Hersteller	Raybiotech
Menge	100 ug
Kategorie	Antibodies Western Blot ELISA Primary Antibodies Proximity Ligation Analysis
Typ	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applikationen	WB, ELISA, PLA
Clon	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKA FVCDQCGAQFSKEDALETHR
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	ZBTB16
Lieferbar
Specificity	Human
Target Name	zinc finger and BTB domain containing 16
Accession Number	AAH29812
Gene Symbol	ZBTB16
Gene ID	7704
Target Synonyms	PLZF, ZNF145
Application notes:	WB-Tr, PLA-Ce, S-ELISA, ELISA
Product Description	Human ZBTB16 monoclonal antibody (100 ug)
Immunogen	ZBTB16 (AAH29812, 381 a.a. ca. 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

101-11954.pdf

101-11954-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 20.12.2024

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail