« Zurück
Home /
Anti-PLCG1 Antibody

Anti-PLCG1 Antibody

ArtNr	101-11275
Hersteller	Raybiotech
Menge	100 ug
Kategorie	Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies Proximity Ligation Analysis
Typ	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applikationen	WB, IF, ELISA, PLA
Clon	Monoclonal
Specific against	Human
Host	Hamster - Armenian
Isotype	IgG1 Kappa
Sequence	LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRE RGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADH FDSRERRAPRRTRVNGDNRL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PLCG1
Lieferbar
Specificity	Human
Target Name	phospholipase C, gamma 1
Accession Number	NP_002651
Gene Symbol	PLCG1
Gene ID	5335
Target Synonyms	PLC-II, PLC1, PLC148, PLCgamma1
Application notes:	PLA-Ce, S-ELISA, ELISA, WB-Re, IF, WB-Ce
Product Description	Human PLCG1 monoclonal antibody (100 ug)
Immunogen	PLCG1 (NP_002651, 1192 a.a. ca. 1291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

101-11275.pdf

101-11275-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 20.12.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern