« Zurück
Home /
Anti-FGF5 Antibody

Anti-FGF5 Antibody

ArtNr	101-10530
Hersteller	Raybiotech
Menge	100 ug
Kategorie	Antibodies Immunoprecipitation Western Blot ELISA Primary Antibodies Proximity Ligation Analysis
Typ	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applikationen	WB, IP, ELISA, PLA
Clon	Monoclonal
Specific against	Human (Homo sapiens)
Host	Hamster - Armenian
Isotype	IgG1 Kappa
Sequence	DCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKA KRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKK PPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	FGF5
Versandbedingung	Gekühlt
Lieferbar
Specificity	Human
Manufacturer - Type	Antibodies\|Primary Antibodies
Manufacturer - Applications	ELISA, Immunoprecipitation, WB, Proximity Ligation Analysis
Storage Conditions	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration	12 months from the date of shipment when stored properly.
Format	In 1x PBS, pH 7.2
Gene Symbols	FGF5
Protein Name & Synonyms	FGF5
Specicifity	Human
Buffers	1x PBS, pH 7.2
Clonality	Monoclonal

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

101-10530.pdf

101-10530-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 21.02.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail