Vergleich

Pegylated, recombinant granulocyte colony-stimulating factor (G-CSF)

ArtNr THP-0083
Hersteller Creative BioMart
Menge 1ea
Kategorie
Typ Proteins
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 1117844-87-7
Similar products 1117844-87-7
Lieferbar
Description
The product is a pegylated, recombinant granulocyte colony-stimulating factor (G-CSF) that was synthetized using a highly site-specific glycoPEGylation technology. The product is a covalent conjugate of Filgrastim with a single methoxy polyethylene glycol (PEG) molecule via a carbohydrate linker consisting of glycine, N-acetylneuraminic acid and N-acetylgalactosamine. The average molecular mass of the product comprises 18, 798 Da for Filgrastim, 203 Da for GalNAc, 338 Da for glycylsialic acid and approximately 20, 000 Da for PEG.
Formula
C866H1372N226O258S9*(C2H4O)n
Sequences
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
CAS No.
1117844-87-7
Molecular Weight
39000.0 Da (glycoPEGylated, approximate)
Synonyms
Not Available
Applications info
Indicated for the reduction in the duration of neutropenia and the incidence of febrile neutropenia in adult patients treated with cytotoxic chemotherapy for malignancy (with the exception of chronic myeloid leukaemia and myelodysplastic syndromes).
Examples of Clinical Use
Reduction in the duration of neutropenia and the incidence of febrile neutropenia
Pharmacodynamics
Mimicking endogenous granulocyte colony-stimulating factors, the product enhances the number and function of circulating neutrophils by binding to endogenous G-CSF receptors. A small increase in monocyte and/or lymphocyte counts may also be observed. Following a single subcutaneous dose administration of 100 ug/kg, the product resulted in a significant increase in neutrophilic granulocyte and large unstained cell counts. G-CSF also increases the antibacterial activities of neutrophils including the phagocytosis. Due to structural similarity between the product and pegfilgrastim, G-CSF receptor binding was equivalent between two molecules. However, the product showed greater time-dependent resistance to neutrophil elastase degradation and greater retention of activity than pegfilgrastim.
Mechanism of action
Endogenous granulocyte colony-stimulating factor (G-CSF) is a glycoprotein that stimulates neutrophil progenitors. It is produced mainly by monocytes, fibroblasts and endothelial cells to promote the development of neutrophils and increase their proliferation and maturation. Subsequently, G-SCF stimulates the release of matured neutrophils from the bone marrow storage pools into the peripheral blood to enhance their function. Via binding to to the human G-CSF receptors, lipegfilgrastim activates the receptor signalling pathway as a growth factor to stimulate proliferation of haematopoietic progenitor cells and their differentiation into mature cells, and promote subsequent release into the peripheral blood. This stimulatory effect of lipegfilgrastim may extend to other single lineage and multilineage progenitors and pluripotent haematopoietic stem cells. The presence of the PEG moiety in lipegfilgrastim decreases the plasma clearance and extends the drug's terminal elimination half-life, allowing for less frequent dosing.
Affected organisms
Not Available
Targets
Target 1. Granulocyte colony-stimulating factor receptor

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1ea
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen