« Zurück
Home /
Recombinant Mouse S100A9/MRP14 Protein

Recombinant Mouse S100A9/MRP14 Protein

ArtNr	RP03159LQ-100ug
Hersteller	Abclonal
Menge	100 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
NCBI	S1A9/MRP14
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	S100-A9; Calgranulin-B; Calprotectin L1H subunit; MRP-14; p14; CAGB; MRP14;S100A9
Lieferbar
Background	S100A8 and S100A9 (also known as MRP8 and MRP14, respectively) are Ca2 binding proteins belonging to the S100 family. They often exist in the form of heterodimer, while homodimer exists very little because of the stability. S100A8/A9 is constitutively expressed in neutrophils and monocytes as a Ca2 sensor, participating in cytoskeleton rearrangement and arachidonic acid metabolism.
Route	N-His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg
Immunogen	Ala2-Lys113
Storage	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Protein Size	14.1 kDa
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	S100A9/MRP14
Protein Formulation	Supplied as 0.22μm filtered solution in PBS, 1mM DTT, 20% Glycerol pH 7.5.
Protein Description	Recombinant Mouse S100A9/MRP14 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Lys113) of mouse S100A9/MRP14 fused with a His tag at the N-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 24 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail