ArtNr |
RP02988-500ug |
Hersteller |
Abclonal
|
Menge |
500 ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Purity |
> 95% as determined by by reducing SDS-PAGE. |
Sequence |
STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH |
NCBI |
Fibrillin-1/FBN1 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Fibrillin-1; Fbn1; Asprosin; Fbn-1 |
Lieferbar |
|
Description |
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Background |
Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved. |
Route |
N-His |
Manufacturers Category |
Proteins |
Endotoxin |
<1EU/μg |
Immunogen |
Ser2732-His2871 |
Storage |
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Manufacturers Research Area |
Other Recombinant Protein |
Gene Symbol |
Fibrillin-1/FBN1 |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Protein Description |
Recombinant Human Fibrillin-1/FBN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2732-His2871) of human Fibrillin-1/FBN1 (Accession #NP_000129.3) fused with a 8×His tag at the N-terminus. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.