« Zurück
Home /
Recombinant Mouse PDGFB Protein

Recombinant Mouse PDGFB Protein

ArtNr	RP02876-500ug
Hersteller	Abclonal
Menge	500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse
Purity	> 95% as determined by SDS-PAGE.
Sequence	SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
NCBI	PDGFB
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS
Lieferbar
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. As growth factor，it plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. It is required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. PDGFB also plays an important role in wound healing.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	<1EU/μg
Immunogen	Ser82-Thr190
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Growth Factor
Gene Symbol	PDGFB
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 4mM HCl.
Protein Description	Recombinant Mouse PDGFB Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser82-Thr190) of mouse PDGFB (Accession #NP_035187.2) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail