« Zurück
Home /
Recombinant Mouse CXCL1/GRO-alpha Protein

Recombinant Mouse CXCL1/GRO-alpha Protein

ArtNr	RP01641-20ug
Hersteller	Abclonal
Menge	20 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse
Purity	> 97% by SDS-PAGE.
Sequence	RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
NCBI	CXCL1/GRO-alpha
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1;CXCL1
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation.Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation.
Route	C-hFc
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Arg20-Lys96
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine receptors
Gene Symbol	CXCL1/GRO-alpha
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Mouse CXCL1/GRO-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg20-Lys96) of mouse CXCL1/GRO-alpha (Accession #NP_032202.1) fused with and a hFc tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 23 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail