« Zurück
Home /
Recombinant Mouse CCL2/MCP-1 Protein

Recombinant Mouse CCL2/MCP-1 Protein

ArtNr	RP01607-100ug
Hersteller	Abclonal
Menge	100 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
NCBI	CCL2
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-C motif chemokine ligand 2,CCL2,GDCF-2,HC11,HSMCR30,MCAF,Mcp1,MCP-1,SCYA2,SMC-CF,CCL2
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Gln 24-Asn148
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine receptors
Gene Symbol	CCL2
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Mouse CCL2/MCP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln 24-Asn148) of mouse CCL2/MCP-1 (Accession #NP_035463.1) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its ability to chemoattract THP-1 cells. The ED₅₀ for this effect is typically 6.2-25.0 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 11 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail