« Zurück
Home /
Recombinant human BDNF Protein

Recombinant human BDNF Protein

ArtNr	RP01243-50ug
Hersteller	Abclonal
Menge	50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
NCBI	BDNF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Brain-derived neurotrophic factor (BDNF) is a member of the nerve growth factor family.The neurotrophin family is comprised of at least four proteins including NGF, BDNF, NT-3, and NT-4/5. These secreted cytokines are synthesized as prepropeptides that are proteolytically processed to generate the mature proteins.BDNF cDNA encodes a 247 amino acid residue precursor protein with a signal peptide and a proprotein that are cleaved to yield the 119 amino acid residue mature BDNF. The amino acid sequence of mature BDNF is identical in all mammals examined. BDNF binds with high affinity and specifically activates the TrkB tyrosine kinase receptor .
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	His129-Arg247
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Growth Factor, Cell Culture related
Gene Symbol	BDNF
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human/Mouse/Rat BDNF Protein is produced by E. coli expression system. The target protein is expressed with sequence (His129-Arg247) of human BDNF (Accession #NP_733929.1.) fused with an initial Met at the N-terminus and a 6×His tag at the C-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA.Immobilized Recombinant Human BDNF at 1 μg/mL (100 μL/well) can bind BDNF Rabbit mAb with a linear range of 0.4-2.15ng/mL.\|2.Measured by its binding ability in a functional ELISA.Immobilized Recombinant Human TrkB at 2 μg/mL (100 μL/well) can bind Recombinant Human BDNF with a linear range of 1.95-258 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail